1 LOCUS BC000007 981 bp mRNA linear PRI 09-DEC-2005
2 DEFINITION Homo sapiens px19-like protein, mRNA (cDNA clone MGC:1082
3 IMAGE:3505068), complete cds.
5 VERSION BC000007.2 GI:33875090
7 SOURCE Homo sapiens (human)
9 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
10 Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
11 Catarrhini; Hominidae; Homo.
12 REFERENCE 1 (bases 1 to 981)
13 AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
14 Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
15 Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
16 Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
17 Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
18 Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
19 Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
20 Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
21 Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
22 McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
23 Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
24 Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
25 Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
26 Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
27 Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
28 Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
29 Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
30 Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
31 CONSRTM Mammalian Gene Collection Program Team
32 TITLE Generation and initial analysis of more than 15,000 full-length
33 human and mouse cDNA sequences
34 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
36 REFERENCE 2 (bases 1 to 981)
37 CONSRTM NIH MGC Project
38 TITLE Direct Submission
39 JOURNAL Submitted (03-NOV-2000) National Institutes of Health, Mammalian
40 Gene Collection (MGC), Bethesda, MD 20892-2590, USA
41 REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
42 COMMENT On Aug 19, 2003 this sequence version replaced gi:12652536.
43 Contact: MGC help desk
44 Email: cgapbs-r@mail.nih.gov
45 Tissue Procurement: ATCC
46 cDNA Library Preparation: Rubin Laboratory
47 cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
48 DNA Sequencing by: Institute for Systems Biology
49 http://www.systemsbiology.org
50 contact: amadan@systemsbiology.org
51 Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
52 Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
54 Clone distribution: MGC clone distribution information can be found
55 through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
56 Series: IRAL Plate: 7 Row: f Column: 3
57 This clone was selected for full length sequencing because it
58 passed the following selection criteria: matched mRNA gi: 31543450.
60 Differences found between this sequence and the human reference
61 genome (build 36) are described in misc_difference features below
62 and these differences were also compared to chimpanzee genomic
63 sequences available as of 09/15/2004.
64 FEATURES Location/Qualifiers
66 /organism="Homo sapiens"
69 /clone="MGC:1082 IMAGE:3505068"
70 /tissue_type="Placenta, choriocarcinoma"
71 /clone_lib="NIH_MGC_21"
76 /note="synonyms: CGI-106, PRELI"
77 /db_xref="GeneID:27166"
82 /product="PX19 protein"
83 /protein_id="AAH00007.1"
84 /db_xref="GI:12652537"
85 /db_xref="GeneID:27166"
87 /translation="MVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREV
88 TPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNINH
89 ARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLARFKSNVTKTMK
90 GFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKAKDLASKAATKKQQQQQQF
94 /note="'G' in cDNA is 'A' in the human genome; no amino
95 acid change. The chimpanzee genome agrees with the cDNA
96 sequence, suggesting that this difference is unlikely to
97 be due to an artifact."
100 /note="'C' in cDNA is 'T' in the human genome. The
101 chimpanzee genome agrees with the cDNA sequence,
102 suggesting that this difference is unlikely to be due to
104 misc_difference 925..981
106 /note="polyA tail: 57 bases do not align to the human
109 1 ctcatggcgg cggcggcggc ggcggcagct gcttgggcgc ggtgcggtgg tgactgagct
110 61 acgagcctgg cggcgggtgt gcgccgagcc ccggcccggc ccggccctcg cgtgcctccc
111 121 aggctccgca cccctgatgc tgcgcgggtg ctgagcccgc ttcggccggg acgatggtga
112 181 agtatttcct gggccagagc gtgctccgga gttcctggga ccaagtgttc gccgccttct
113 241 ggcagcggta cccgaatccc tatagcaaac atgtcttgac ggaagacata gtacaccggg
114 301 aggtgacccc tgaccagaaa ctgctgtccc ggcgactcct gaccaagacc aacaggatgc
115 361 cacgctgggc cgagcgacta tttcctgcca atgttgctca ctcggtgtac gtcctggagg
116 421 actctattgt ggacccacag aatcagacca tgactacctt cacctggaac atcaaccacg
117 481 cccggctgat ggtggtggag gaacgatgtg tttactgtgt gaactctgac aacagtggct
118 541 ggactgaaat ccgccgggaa gcctgggtct cctctagctt atttggtgtc tccagagctg
119 601 tccaggaatt tggtcttgcc cggttcaaaa gcaacgtgac caagactatg aagggttttg
120 661 aatatatctt ggctaagctg caaggcgagg ccccttccaa aacacttgtt gagacagcca
121 721 aggaagccaa ggagaaggca aaggagacgg cactggcagc tacagagaag gccaaggacc
122 781 tcgccagcaa ggcggccacc aagaagcagc agcagcagca acagtttgtg tagccagtct
123 841 accaccacca cagcacccca gacagctagg cttagcccct ctgccctccc ttcattgtac
124 901 tttatcatta aaaatcaact tccaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
125 961 aaaaaaaaaa aaaaaaaaat a