2 ## Bioperl Test Harness Script for Modules
5 ## SeqWords.t, based on SeqStats.t
6 # Derek Gatherer, 11th November 2003
10 # to handle systems with no installed Test module
11 # we include the t dir (where a copy of Test.pm is located)
13 eval { require Test; };
14 if( $@ ) { use lib 't'; }
20 use Bio::Tools::SeqWords;
25 my ($seqobj, $count, $seqobj_stats, $wt);
27 $seqobj = Bio::PrimarySeq->new(-seq=>'ACTGTGGCGTCAACTGACTGGC',
28 -alphabet=>'dna', -id=>'test');
29 $seqobj_stats = Bio::Tools::SeqWords->new(-seq=>$seqobj);
31 ok defined($seqobj_stats) && ref($seqobj_stats) &&
32 $seqobj_stats->isa('Bio::Tools::SeqWords');
34 $count = $seqobj_stats->count_words(4);
35 ok $count->{'ACTG'}, 3;
36 ok $count->{'TGGC'}, 1;
37 ok $count->{'GTCA'}, 1;
39 $count = $seqobj_stats->count_overlap_words(4);
40 ok $count->{'ACTG'}, 3;
41 ok $count->{'TGGC'}, 2;
42 ok $count->{'GTCA'}, 1;
43 ok $count->{'GTGG'}, 1;
46 $seqobj = Bio::PrimarySeq->new(-seq=>'MQSERGITIDISLWKFETSKYYVTIDISSLWKF',
47 -alphabet=>'protein', -id=>'test');
48 $seqobj_stats = Bio::Tools::SeqWords->new('-seq' => $seqobj);
49 ok defined($seqobj_stats) && ref($seqobj_stats) &&
50 $seqobj_stats->isa('Bio::Tools::SeqWords');
52 $count = $seqobj_stats->count_words(4);
53 ok $count->{'MQSE'}, 1;
54 ok $count->{'LWKF'}, 1;
55 ok $count->{'IDIS'}, 2;
57 $count = $seqobj_stats->count_overlap_words(4);
58 ok $count->{'MQSE'}, 1;
59 ok $count->{'LWKF'}, 2;
60 ok $count->{'IDIS'}, 2;